PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_59262.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MIKC_MADS
Protein Properties Length: 209aa    MW: 24084.6 Da    PI: 7.7611
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_59262.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.35.6e-30959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krien+snrqvtfskR+ngilKKA+E+SvLCdaev v++fss gkly+++s
  MLOC_59262.2  9 KRIENQSNRQVTFSKRKNGILKKAKEISVLCDAEVGVVVFSSAGKLYDFCS 59
                  79***********************************************96 PP

2K-box72.89.8e-2571165195
         K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                   yq++sgk l+++k++sl+ e++++kke++n+q e+Rhl+GedL+sL+ keL  +e++L+++l++  +k++e++ + +++ ++ e+e++    + +
  MLOC_59262.2  71 YQTNSGKILWDEKHKSLSAEIDRIKKENDNMQIELRHLKGEDLNSLQPKELIMIEEALDNGLTSLHEKQMEHYDRLMKHGKMLEDENKLLAFKVH 165
                   89999999*********************************************************************999999999887766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.828161IPR002100Transcription factor, MADS-box
SMARTSM004327.9E-42160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.53E-34296IPR002100Transcription factor, MADS-box
CDDcd002651.19E-42280No hitNo description
PRINTSPR004047.1E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014863.9E-1682164IPR002487Transcription factor, K-box
PROSITE profilePS5129712.58384170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGRGKIEIKR IENQSNRQVT FSKRKNGILK KAKEISVLCD AEVGVVVFSS AGKLYDFCSP  60
KTSLSRILEK YQTNSGKILW DEKHKSLSAE IDRIKKENDN MQIELRHLKG EDLNSLQPKE  120
LIMIEEALDN GLTSLHEKQM EHYDRLMKHG KMLEDENKLL AFKVHQHDIA LSGSMRDLEL  180
GYHPDRDFAA QMPITFRVQP SHPNLQEDT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-21171169Myocyte-specific enhancer factor 2B
1tqe_Q5e-21171169Myocyte-specific enhancer factor 2B
1tqe_R5e-21171169Myocyte-specific enhancer factor 2B
1tqe_S5e-21171169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU7403070.0KU740307.1 Hordeum vulgare PISTILLATA-like MADS-box transcription factor PI-2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288308.11e-141MADS-box transcription factor 2-like
SwissprotQ407021e-139MADS2_ORYSJ; MADS-box transcription factor 2
TrEMBLA0A140HIG01e-155A0A140HIG0_HORVU; PISTILLATA-like MADS-box transcription factor PI-2
TrEMBLM0XE081e-155M0XE08_HORVD; Uncharacterized protein
STRINGMLOC_59262.21e-154(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-72MIKC_MADS family protein
Publications ? help Back to Top
  1. Bartlett M, et al.
    Evolutionary Dynamics of Floral Homeotic Transcription Factor Protein-Protein Interactions.
    Mol. Biol. Evol., 2016. 33(6): p. 1486-501
    [PMID:26908583]